DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13369 and MAK32

DIOPT Version :9

Sequence 1:NP_569850.1 Gene:CG13369 / 31007 FlyBaseID:FBgn0025640 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_009946.1 Gene:MAK32 / 850381 SGDID:S000000612 Length:363 Species:Saccharomyces cerevisiae


Alignment Length:348 Identity:68/348 - (19%)
Similarity:117/348 - (33%) Gaps:113/348 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QTEVLVF--GSAIIDFISYTTRLPKAGETLHGHRFQIGY----GGKGA----NQCVAAARQGSRT 57
            :|:.||.  |..|||.|..:             ::.|.|    ||.|.    ..|:.::...:..
Yeast     9 ETKSLVITNGMFIIDDIERS-------------KYNIHYKNVPGGGGTFAILGACIISSGNVTSK 60

  Fly    58 AL--VAKLGADTFGSDYLRHLREERVNVNHVEQLAEETTGVAQIAVSDGGENNIIIVVGANNRLS 120
            .|  :...|:| |..:.:|.:.....:|...:..:..||                  .|.|....
Yeast    61 GLKWIVDRGSD-FPKEVIREIDSWGTDVRFRDDFSRLTT------------------KGLNYYEG 106

  Fly   121 SCDVSSAKALFQEAKVLVCQ-LETPVEATLTALRAF-------RGVSIVNAAPAMADTPPELLQL 177
            |.|:...|.|..:.::.|.. :.|..:..:..:.||       |.:.|:|          :||::
Yeast   107 SDDLRKFKFLTPKKQINVDDWISTFGQKIIDEMHAFHLLCSGSRCLDIIN----------DLLRV 161

  Fly   178 ASIFCVNESEAALMTQMPDIGNIEHAEDA--------VGKLIAAGA------------------- 215
            .|  ........:....||:.:.:|..|.        |..:::..|                   
Yeast   162 KS--SKGTKPIVIWEPFPDLCDFDHQNDIKSVMQRNDVTVILSPNAEESSRLFGLSSKEPTSLEE 224

  Fly   216 ---------------NTVIITLGKLGAVFGSADSKG--VCQHVAAPSVPPE-KVVDTTGAGDAFI 262
                           |..|:..|.||::..|...|.  ...|..|.....: ||:|.||.|::|:
Yeast   225 CLALAHRFDDFMDENNMCILRCGALGSISVSEKFKNGRTYDHFPAYHFKTQSKVLDPTGGGNSFL 289

  Fly   263 GALAHNLARHPTRKLEEHIAAAC 285
            |..|.:.|.  |:.|:  ||:.|
Yeast   290 GGFAVSYAL--TKSLD--IASIC 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13369NP_569850.1 ribokinase 6..303 CDD:238579 67/345 (19%)
MAK32NP_009946.1 MAK32 13..344 CDD:238918 67/344 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.