DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13369 and AT1G66430

DIOPT Version :9

Sequence 1:NP_569850.1 Gene:CG13369 / 31007 FlyBaseID:FBgn0025640 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_564875.2 Gene:AT1G66430 / 842961 AraportID:AT1G66430 Length:384 Species:Arabidopsis thaliana


Alignment Length:324 Identity:78/324 - (24%)
Similarity:138/324 - (42%) Gaps:46/324 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLVFGSAIIDFISYTTRLPKAGETLHGHRFQIGYGGKGANQCVAAARQGSRTALVAKLGADTFGS 70
            |:.||..:|||:..|:.|..|    ....|:...||..||..|..||.|..:|.:.|:|.|.||.
plant    66 VVCFGEMLIDFVPTTSGLSLA----DAPAFKKAPGGAPANVAVGIARLGGSSAFIGKVGEDEFGY 126

  Fly    71 DYLRHLREERVNVNHVEQLAEETTGVAQIAVSDGGENNIIIVVGANNRLSSCDVSSAKA-----L 130
            .....|::..||.:.:.......|.:|.:.:::.||...:..     |..|.|:...::     |
plant   127 MLANILKDNNVNNDGMRFDPGARTALAFVTLTNEGEREFMFY-----RNPSADMLLEESELDFDL 186

  Fly   131 FQEAKVL----VCQLETPVE-ATLTALRAFRGVSIVNAA---------PAMADTPPELLQL---A 178
            .::||:.    :..:..|.: |.::|.:|.:...::.:.         |:..:...|:|.:   |
plant   187 IKKAKIFHYGSISLITEPCKSAHISAAKAAKEAGVILSYDPNLRLPLWPSADNAREEILSIWETA 251

  Fly   179 SIFCVNESEAALMTQMPDIGNIEHAEDAVGKLIAAGANTVIITLGKLGAVFGSADSKGVCQHVAA 243
            .|..::|.|...:|:    |...:.::.|.||.......:::|.|..|..:.:.|..|....:..
plant   252 DIIKISEEEIVFLTK----GEDPYDDNVVRKLFHPKLKLLLVTEGPEGCRYYTKDFSGRVHGLKV 312

  Fly   244 PSVPPEKVVDTTGAGDAFIGALAHNLAR-----HPTRKLEEHIAAACAVASQSVQLPGTQSSFP 302
                  .|||||||||||:..:...||.     ....:|.|.:..|.|..:.:|::.|...:.|
plant   313 ------DVVDTTGAGDAFVAGILSQLANDLSLLQDEERLREALMFANACGALTVKVRGAIPALP 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13369NP_569850.1 ribokinase 6..303 CDD:238579 78/324 (24%)
AT1G66430NP_564875.2 PLN02323 55..384 CDD:215183 78/324 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918144at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X600
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.