DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13369 and AT1G06730

DIOPT Version :9

Sequence 1:NP_569850.1 Gene:CG13369 / 31007 FlyBaseID:FBgn0025640 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_172158.1 Gene:AT1G06730 / 837184 AraportID:AT1G06730 Length:488 Species:Arabidopsis thaliana


Alignment Length:346 Identity:74/346 - (21%)
Similarity:120/346 - (34%) Gaps:94/346 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EVLVFGSAIIDFISYTTRLPKAGETLHGHRFQI-------------GYGGKGANQCVAAARQGSR 56
            :|...|:..:|.:.....||...   .|.|..:             ...|...|..:||||.|..
plant    86 DVSTLGNLCVDIVLSVHELPPPS---RGERKALMDELSMSPPDKKYWEAGGNCNMAIAAARLGLH 147

  Fly    57 TALVAKLGADTFGSDYLRHLREERVNVNHVEQLAEETTGVAQIAVSDGGEN---------NII-- 110
            ...:..:|.:.:|...|..|.||               |:..:|: :||.|         .:|  
plant   148 CVAIGHVGDEIYGEFLLDVLHEE---------------GIGTVAL-NGGTNEKDTSSFCETLICW 196

  Fly   111 IVVGANNRLSSC---------------DVS-SAKALFQEAKVLVCQ------------LETPVEA 147
            ::|....|...|               |:| ..|...:::|||.|.            :.|...|
plant   197 VLVDPLQRHGFCSRADFKEEPAFSWITDLSDEVKMAIRQSKVLFCNGYDFDDFSPSFIMSTIDYA 261

  Fly   148 TLTALRAF-----RGVSIVNAAPAMADTPPELLQLASIFCVNESEAALMTQMPDIGNIEHAEDAV 207
            .......|     ||.|:....|.........|:::.:..:...|...:|      .|.:...|.
plant   262 AKVGTAIFFDPGPRGKSLSKGTPDERRALAHFLRMSDVLLLTSEEVEALT------GIRNPVKAG 320

  Fly   208 GKLIAAGANT--VIITLGKLGAVFGSADSKGVCQHVAAPSVPPEKVVDTTGAGDAFIGALA---- 266
            .:::..|..|  ||:.:|..|::..:..|..|     ||:...| ||||.|.||:|:.|:|    
plant   321 QEILRNGKGTKWVIVKMGPKGSILVTKSSVSV-----APAFKVE-VVDTVGCGDSFVAAIALGYI 379

  Fly   267 HNLARHPTRKLEEHIAAACAV 287
            .|:....|..:...:.||.|:
plant   380 RNMPLVNTLTIANAVGAATAM 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13369NP_569850.1 ribokinase 6..303 CDD:238579 74/345 (21%)
AT1G06730NP_172158.1 PLN02341 1..485 CDD:215195 74/346 (21%)
RbsK 86..420 CDD:223598 74/346 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918144at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.