DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13369 and AT4G28706

DIOPT Version :9

Sequence 1:NP_569850.1 Gene:CG13369 / 31007 FlyBaseID:FBgn0025640 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001190863.1 Gene:AT4G28706 / 828990 AraportID:AT4G28706 Length:440 Species:Arabidopsis thaliana


Alignment Length:367 Identity:84/367 - (22%)
Similarity:139/367 - (37%) Gaps:93/367 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLVFGSAIIDFISYTTRLPKAGETLHGHRFQIGYGGKGANQCVAAARQGSRTALVAKLGADTFGS 70
            ||..|...:||::.....|:|.:.:.....::..||..||....|||.|..:.|::|:..|:.|.
plant    51 VLGCGGIAVDFLATVDSYPQADDKIRSTSLKVQGGGNAANALTCAARLGLNSRLISKVANDSQGK 115

  Fly    71 DYLRHLREERVNVNHVEQLAEETTGVAQIAVSDGGENNIIIVVGANNRLSSCDVSSAKAL--FQE 133
            ..|..|..:.|:.:.:....|..:....|.|.:..:....|....:..:...|:|.:..|  ...
plant   116 GMLEELEADGVDTSFIVVSKEGNSPFTYILVDNQTKTRTCIHTPGDPPMLPTDLSQSSMLSALDR 180

  Fly   134 AKVLVCQLETPVEATLTALRAFRGVSIVNAAPAMADTP------PELLQLAS-IFC--------- 182
            |.::...:.....|.:.|..|.|     ...|.:.||.      .:||..|. :.|         
plant   181 ASIVYFDVRLHETALVIAKEASR-----KKIPILVDTEKKRDGLDDLLPFADYVVCPENFPQTWT 240

  Fly   183 -VNESEAALM----------------------------------TQMPDIGN----IEHAEDA-- 206
             |:.:..||:                                  :|..||.:    ::|.:|:  
plant   241 EVSSTPGALVSMLLRLPKLKFVIVTSGEHGCLMVQRASKAEVFESQETDIESLLETLKHRKDSTT 305

  Fly   207 ---------VGKLIAAGANTVIITLGKLGAVFGSADSKGVCQHVAAPSVPPEKVVDTTGAGDAFI 262
                     ..||.|.|..|:   .|:|  ..|:|:           .:|||::|||||||||||
plant   306 TFPTCVSSETTKLKANGVGTM---TGRL--FLGTAE-----------KIPPEELVDTTGAGDAFI 354

  Fly   263 GALAHNL-ARHPTRKLEEHIAAACAVASQSVQLPGTQSSFPH 303
            ||:.:.: |..|..|:   :..|..||..|.:..|.::..||
plant   355 GAVLYAICAGMPPEKM---LPFAAQVAGCSCRALGARTGLPH 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13369NP_569850.1 ribokinase 6..303 CDD:238579 82/365 (22%)
AT4G28706NP_001190863.1 ribokinase_group_B 50..393 CDD:238920 82/365 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918144at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X600
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.880

Return to query results.
Submit another query.