DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13369 and CG42395

DIOPT Version :9

Sequence 1:NP_569850.1 Gene:CG13369 / 31007 FlyBaseID:FBgn0025640 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001138182.3 Gene:CG42395 / 7354436 FlyBaseID:FBgn0259741 Length:179 Species:Drosophila melanogaster


Alignment Length:136 Identity:29/136 - (21%)
Similarity:53/136 - (38%) Gaps:35/136 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 MADT--------PPELLQLASIFCVNES----------EAALMTQMPDIGNIEHAEDAVGKLIAA 213
            ||:|        |...:.:||...|.||          :.::::..|...:..|:..::..|  |
  Fly     1 MAETLHYLILRNPSSQIVIASANAVLESIGLENWKIPVDDSIVSLPPSAQSYVHSHSSLYCL--A 63

  Fly   214 GANTVIITLGKLG---AVFGSADSKGVCQHVAAPSVPPEKVVDTTGAGDA-----FI---GALAH 267
            |.:...:.|..:|   |:|.||    .|::|........:.:|:....|.     |:   ..:|.
  Fly    64 GCHYHFMRLAGIGGASAIFMSA----YCKYVLRDIESIREQLDSQAFADVANRIHFLHSFALMAM 124

  Fly   268 NLARHP 273
            .||.:|
  Fly   125 PLAHYP 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13369NP_569850.1 ribokinase 6..303 CDD:238579 29/136 (21%)
CG42395NP_001138182.3 DUF423 83..168 CDD:282144 11/52 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456441
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.