DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13369 and CG3809

DIOPT Version :9

Sequence 1:NP_569850.1 Gene:CG13369 / 31007 FlyBaseID:FBgn0025640 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_731676.2 Gene:CG3809 / 41476 FlyBaseID:FBgn0037995 Length:396 Species:Drosophila melanogaster


Alignment Length:281 Identity:61/281 - (21%)
Similarity:101/281 - (35%) Gaps:65/281 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 RTALVAKLGADTFGSDYLRHLREERVNVNHVEQLAEE-TTGVAQIAVSDGGENNIIIVVGANNRL 119
            |...:..:|.|..|....:..:.:  .:..:.||.|| .||...:.: :|...:::..:||.:..
  Fly   131 RAVFIGSVGKDKLGDRIEKRAKSD--GLLTLYQLKEELPTGSCAVII-NGPNRSLVANLGAASLF 192

  Fly   120 SS---------CDVSSAKALFQEAKVL-VCQLETPVEATLTALRAFRGVSIVNAAPAMA-----D 169
            |.         |.:..|:..:.....| ||  ...||...........:.|:|.:....     :
  Fly   193 SDDWIDEDDNICALDRAEYFYFTGFFLAVC--PPAVERVARMCCETNRIMILNFSAVFVLQMQKE 255

  Fly   170 TPPELLQLASIFCVNESEA------------------ALMTQMPDIGNIEHAEDAVGKLIAAGAN 216
            ....:||...|...|:.||                  :.:.|||       .|:...:|      
  Fly   256 ALGNILQYVDIIICNKEEAIAFSDTNDWKTKNIFEIGSRLQQMP-------KENTRPRL------ 307

  Fly   217 TVIITLGKLGAVFGSADSKGVCQHVAAPSVPPEK---VVDTTGAGDAFIGA-LAHNLARHPTRKL 277
             |:|| ..:..|....|:..|.::    .|||.|   :.||.|.||||:|. ||..:.|.|   |
  Fly   308 -VMIT-DAVCPVLVFQDNDRVLEY----PVPPVKQGEIFDTNGCGDAFVGGFLAMYVQRMP---L 363

  Fly   278 EEHIAAACAVASQSVQLPGTQ 298
            :..|......:.|.:.:.|.|
  Fly   364 DYCIRTGIFASQQVLHVVGVQ 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13369NP_569850.1 ribokinase 6..303 CDD:238579 61/281 (22%)
CG3809NP_731676.2 PTZ00247 50..392 CDD:240328 61/281 (22%)
adenosine_kinase 54..382 CDD:238573 59/277 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456461
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0524
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.