DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13369 and CG7328

DIOPT Version :9

Sequence 1:NP_569850.1 Gene:CG13369 / 31007 FlyBaseID:FBgn0025640 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_649181.1 Gene:CG7328 / 40204 FlyBaseID:FBgn0036942 Length:306 Species:Drosophila melanogaster


Alignment Length:321 Identity:76/321 - (23%)
Similarity:113/321 - (35%) Gaps:59/321 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAQTE-VLVFGSAIIDFISYTTRLPKAGETLHGHRFQIGYGGKGANQCVAAARQGSRTALVAKLG 64
            |.|.: ||..|..:|||::.....|....   ..|...|:..:|.|     |...|....|....
  Fly     1 MTQVKSVLCVGCTVIDFVTINGSYPMEDT---DRRCLDGFWQRGGN-----ASNVSTVLRVLGCK 57

  Fly    65 ADTFG----SDYLR----HLREERVNVNHVEQLAEETTGVAQIAVSDGGENNIIIVVGANNRLSS 121
            .|.||    ||..|    .|.:..:..|.......:....:.|...|.|...||          .
  Fly    58 VDFFGMLSRSDGFRVLLDDLSKREIGTNDCPFTDRDPPFSSVILAQDSGTRTII----------H 112

  Fly   122 CDVSSAKALFQE-AKVLVCQL--------ETPVEATLTALRAFR--------GVSIVNAAPAMAD 169
            |:....:..::: :|:.:.|.        .||  .||..:::.|        |:.|........:
  Fly   113 CNKDYPQTTYEDFSKINLSQYGWVHFEARNTP--HTLKMMQSIREYNQRTGQGIIISLDFETRYE 175

  Fly   170 TPPELLQLASIFCVNESEAA--LMTQMPDIGNIEHAEDAVGKLIAAGANTVII-TLGKLGAVFGS 231
            ...||..... |.|...|.|  |..:.|.    :..|:...|:...|...|.| ..|..||  |:
  Fly   176 QNQELCAPCD-FVVFSKELAGQLGWKTPR----QSCEELASKIPEGGPKPVFICPWGSAGA--GA 233

  Fly   232 ADSKGVCQHVAAPSVPPEKVVDTTGAGDAFIGALAHNLARHPTRKLEEHIAAACAVASQSV 292
            .|:.|  .:....|...:|||||.||||:|:....:...: ..|.|.|.:..|..|||..:
  Fly   234 MDANG--NYYEMSSYKQDKVVDTLGAGDSFMAGFIYATLK-ARRSLAEAVDFANRVASHKI 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13369NP_569850.1 ribokinase 6..303 CDD:238579 74/315 (23%)
CG7328NP_649181.1 Ketohexokinase 6..297 CDD:238914 74/316 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456463
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.