DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13369 and CG7551

DIOPT Version :9

Sequence 1:NP_569850.1 Gene:CG13369 / 31007 FlyBaseID:FBgn0025640 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_648466.1 Gene:CG7551 / 39280 FlyBaseID:FBgn0036161 Length:322 Species:Drosophila melanogaster


Alignment Length:347 Identity:71/347 - (20%)
Similarity:119/347 - (34%) Gaps:100/347 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLVFGSAIIDFISYTTRLPKAGETLHGHRFQIG----YGGKGANQCVAAARQGSRTALVAKLGAD 66
            ||..|:..|||:|...|.|:.    :.|:..||    .|||.:|.|...|..|.:...:..|   
  Fly    17 VLCIGTTTIDFVSTIKRFPEE----NSHQKVIGGYWIRGGKASNNCTVLANLGVKVEFLGML--- 74

  Fly    67 TFGSDYLRHLREERVNVNHVEQLAEETTGVAQIAVSDGGENNIIIVVGANNRLSSCDVS---SAK 128
                                     .:..|.|:.|.|.....|||     :...:||..   |:.
  Fly    75 -------------------------SSWSVFQVLVDDLKSRGIII-----DNCPTCDQGAPFSSV 109

  Fly   129 ALFQEAK---VLVCQLETPVEATLTALRAFRGVSI-----VNAAPAMADTPPELLQLASIFCVNE 185
            .|.:..|   ::.|....|    ..::..||.:::     ::......|....:::....:..|.
  Fly   110 ILTKATKTRNIVYCNNNFP----YVSIDDFRKLNLNQYGWIHIRALYFDKSLPMVKDIEAYNANR 170

  Fly   186 SEAALMTQMPDIGNIE-------------------------HAEDAVGKL-----IAAGANT--- 217
            .|..:::...| .|::                         ..|||..:|     :..|.|.   
  Fly   171 KEKIVLSMEFD-NNLDDMWPLMDYCDYAVFSKKLAQPNGWVSLEDACMQLDERLRMRWGLNLKRP 234

  Fly   218 -VIITLGKLGAVFGSADSKGVCQHVAAPSVPPEKVVDTTGAGDAFIGALAHNLARHPTRKLEEHI 281
             |::..|..||  |..|..|...||....  |:::||..||||.|:||..:.|...     |..:
  Fly   235 YVVVLWGDQGA--GILDLNGNFTHVKPHK--PKRIVDALGAGDTFVGAFIYALYIR-----ERSV 290

  Fly   282 AAACAVASQSVQLPGTQSSFPH 303
            :.|....::......|::.:.|
  Fly   291 SVAVDFGNRMASYKCTKNGYDH 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13369NP_569850.1 ribokinase 6..303 CDD:238579 70/345 (20%)
CG7551NP_648466.1 Ketohexokinase 16..311 CDD:238914 70/344 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456467
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.