DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13369 and CG12289

DIOPT Version :9

Sequence 1:NP_569850.1 Gene:CG13369 / 31007 FlyBaseID:FBgn0025640 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_648465.2 Gene:CG12289 / 39279 FlyBaseID:FBgn0036160 Length:378 Species:Drosophila melanogaster


Alignment Length:79 Identity:23/79 - (29%)
Similarity:37/79 - (46%) Gaps:5/79 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 VIITLGKLGAVFGSADSKGVCQHVAAPSVPPEKVVDTTGAGDAFIGALAHNLARHPTRKLEEHIA 282
            :|:....|||  |...::|  ::...|:..|:|::|..|..|.|.....: .|....|:|.|.:.
  Fly   234 IIVPWSSLGA--GCMTTEG--EYFEVPAHKPKKIIDRVGDSDCFTAGFIY-AAFVRQRRLAEAVD 293

  Fly   283 AACAVASQSVQLPG 296
            .|.||||..:...|
  Fly   294 FANAVASYKLGYVG 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13369NP_569850.1 ribokinase 6..303 CDD:238579 23/79 (29%)
CG12289NP_648465.2 Ketohexokinase 12..309 CDD:238914 23/79 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456465
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.