DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13369 and Adk

DIOPT Version :9

Sequence 1:NP_569850.1 Gene:CG13369 / 31007 FlyBaseID:FBgn0025640 Length:304 Species:Drosophila melanogaster
Sequence 2:XP_006251693.1 Gene:Adk / 25368 RGDID:2046 Length:403 Species:Rattus norvegicus


Alignment Length:345 Identity:81/345 - (23%)
Similarity:139/345 - (40%) Gaps:56/345 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TEVLVFG--------SAII--DFISYTTRLPK---AGETLHGH-------RFQIGY--GGKGANQ 46
            :|.::||        ||::  ||:...:..|.   ..|..|..       :|::.|  ||...|.
  Rat    63 SENVLFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELVKKFKVEYHAGGSTQNS 127

  Fly    47 CVAA---ARQGSRTA-LVAKLGADTFGSDYLRHLREERVNVNHVEQLAEETTGVAQIAVSDGGEN 107
            ...|   .::..|.| ....:|.|.||........:..|:.::.|| .|:.||.....::.|..:
  Rat   128 MKVAQWMIQEPHRAATFFGCIGIDKFGEILKSKAADAHVDAHYYEQ-NEQPTGTCAACITGGNRS 191

  Fly   108 NIIIVVGAN--NRLSSCDVSSAKALFQEAKV-------LVCQLETPVEATLTALRAFRGVSIVNA 163
            .:..:..||  .:....|:.:...|.::|:|       |....|:.::....|....|..::..:
  Rat   192 LVANLAAANCYKKEKHLDLENNWMLVEKARVYYIAGFFLTVSPESVLKVARYAAENNRTFTLNLS 256

  Fly   164 APAMA----DTPPELLQLASIFCVNESEAALMT-----QMPDIGNIEHAEDAVGKLIAAGANTVI 219
            ||.::    :...|::....|...||:|||...     :..||..|.....|:.|:.:....|||
  Rat   257 APFISQFFKEALMEVMPYVDILFGNETEAATFAREQGFETKDIKEIARKTQALPKVNSKRQRTVI 321

  Fly   220 ITLGKLGAVFGSADSKGVCQHVAAPSVP--PEKVVDTTGAGDAFIGALAHNLARHPTRKLEEHIA 282
            .|.|:...:..:.:..     .|.|.:.  .|::|||.||||||:|.....|..:  :.|.|.|.
  Rat   322 FTQGRDDTIVATGNDV-----TAFPVLDQNQEEIVDTNGAGDAFVGGFLSQLVSN--KPLTECIR 379

  Fly   283 AACAVASQSVQLPGTQSSFP 302
            |....||..::..|  .:||
  Rat   380 AGHYAASVIIRRTG--CTFP 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13369NP_569850.1 ribokinase 6..303 CDD:238579 80/343 (23%)
AdkXP_006251693.1 PTZ00247 60..402 CDD:240328 81/345 (23%)
ribokinase_pfkB_like 70..402 CDD:294126 78/338 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0524
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.