DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsp37A and SRN2

DIOPT Version :9

Sequence 1:NP_001259101.1 Gene:Vsp37A / 31006 FlyBaseID:FBgn0016038 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_013220.1 Gene:SRN2 / 850810 SGDID:S000004109 Length:213 Species:Saccharomyces cerevisiae


Alignment Length:146 Identity:34/146 - (23%)
Similarity:63/146 - (43%) Gaps:38/146 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 DELKQLDRDPEFFEDFIEEMSVVQYLNEELDSMMDQVEIISRENECKGIHLVELKRRLSDDFTAL 109
            |:.|||:   |.|||..|:...||.|.|.. .:::...:.|.::     :..|..::..|  .||
Yeast    97 DQFKQLE---ENFEDLHEQKDKVQALLENC-RILESKYVASWQD-----YHSEFSKKYGD--IAL 150

  Fly   110 KNLGEKCDRLNKKYFKKSDEYAPQHIRELLQIAASNADGDCDRHVEHFLNGKTDVQTFLNTYQWS 174
            |   :|.::..||..::|.:.      |....:..:|| |.|:.::::|:               
Yeast   151 K---KKLEQNTKKLDEESSQL------ETTTRSIDSAD-DLDQFIKNYLD--------------- 190

  Fly   175 KKISTERKAKEERLGT 190
              |.|:...:.|:|.|
Yeast   191 --IRTQYHLRREKLAT 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsp37ANP_001259101.1 Mod_r 42..181 CDD:284587 31/135 (23%)
SRN2NP_013220.1 Mod_r 57..202 CDD:399880 32/142 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104152
Panther 1 1.100 - - LDO PTHR13678
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.