DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsp37A and VPS37-1

DIOPT Version :9

Sequence 1:NP_001259101.1 Gene:Vsp37A / 31006 FlyBaseID:FBgn0016038 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_190880.1 Gene:VPS37-1 / 824478 AraportID:AT3G53120 Length:217 Species:Arabidopsis thaliana


Alignment Length:184 Identity:45/184 - (24%)
Similarity:83/184 - (45%) Gaps:29/184 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 AQRPPTDSSEAKEQEAGESDN-LPNLCTLSLDELKQLDRDPEFFEDF---IEEMSVVQYLNEEL- 74
            :.||.:....:.:...||:.. :..|...|:|||::|..|.:.::.|   ::::.|...:.:|| 
plant    37 SSRPQSSGQISAQVSPGEAAGIIVFLKDKSVDELRKLLSDKDAYQQFLLSLDQVKVQNNIKDELR 101

  Fly    75 --------DSMMDQVEIISRENECKGIHLVELKRRLSDDFTALKNLGEKCDRLNKKYFKKSDEYA 131
                    |::..:.:|:...|:|:.|...||.       ||.:.|.| .:|..::..|   .|:
plant   102 RETLQLARDNLEKEPQIMELRNQCRIIRTTELA-------TAQEKLNE-LERQKEEILK---FYS 155

  Fly   132 PQHIRELLQIAASNADGDCDRHVEHFLNGKTDVQTFLNTYQWSKKIST--ERKA 183
            |..:...||.|.:..|.:.:...|.||..:.|...|:..|   ||:.|  .|:|
plant   156 PGSLLHKLQEAMNQVDEESEALQEKFLEKEIDTAAFVQKY---KKLRTTYHRRA 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsp37ANP_001259101.1 Mod_r 42..181 CDD:284587 38/152 (25%)
VPS37-1NP_190880.1 Mod_r 63..205 CDD:284587 38/155 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3270
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104152
Panther 1 1.100 - - LDO PTHR13678
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.