DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsp37A and AT2G36680

DIOPT Version :9

Sequence 1:NP_001259101.1 Gene:Vsp37A / 31006 FlyBaseID:FBgn0016038 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_850268.2 Gene:AT2G36680 / 818240 AraportID:AT2G36680 Length:218 Species:Arabidopsis thaliana


Alignment Length:177 Identity:43/177 - (24%)
Similarity:78/177 - (44%) Gaps:15/177 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 AQRPPTDSSEAKEQEAGESDN-LPNLCTLSLDELKQLDRDPEFFEDFIEEMSVVQYLNEELDSMM 78
            :.||.|..........||:.. :..|...|:|||::|..|.:.::.|:..:..|...|...:.:.
plant    37 SSRPQTSGQIPSHVSPGEAAGIIAILKDKSVDELRKLLSDKDAYQQFLHSLDQVTIQNNIREELR 101

  Fly    79 DQVEIISRENECKGIHLVELKR-----RLSDDFTALKNLGEKCDRLNKKYFKKSDEYAPQHIREL 138
            .:...::|||..|...:|||:.     |.|:..||.:.|.| .:...::..|   .|:|..:...
plant   102 KETLHLARENLEKEPQIVELRNQCRIIRTSELATAQEKLNE-LENQREEILK---FYSPGSLLHR 162

  Fly   139 LQIAASNADGDCDRHVEHFLNGKTDVQTFLNTYQWSKKISTE--RKA 183
            ||.|.:..|.:.:...:.|:....|...|:..|   ||:.::  |:|
plant   163 LQDAMNQVDEESEELQQKFMEKDIDTAAFVQKY---KKLRSKYHRRA 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsp37ANP_001259101.1 Mod_r 42..181 CDD:284587 35/145 (24%)
AT2G36680NP_850268.2 KLF8_12_N <10..>53 CDD:424081 3/15 (20%)
Mod_r 63..206 CDD:399880 36/149 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3270
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104152
Panther 1 1.100 - - O PTHR13678
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.