DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsp37A and vps37ba

DIOPT Version :9

Sequence 1:NP_001259101.1 Gene:Vsp37A / 31006 FlyBaseID:FBgn0016038 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001093466.1 Gene:vps37ba / 559483 ZFINID:ZDB-GENE-060526-254 Length:288 Species:Danio rerio


Alignment Length:159 Identity:35/159 - (22%)
Similarity:68/159 - (42%) Gaps:18/159 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LCTLSLDELKQLDRDPEFFEDFIEEMSVVQYLNEELDSMMDQVEIISRENECKGIHLVELKRRLS 103
            |.:.:|.:|.:|..|.:....||:|...::.|.:..::.:.....::.:|......|...|..|:
Zfish     8 LGSYTLTQLNELLEDDDKLNKFIDESEEIKGLQQNKETTLANNRFLAEQNLLLQPKLDHQKNELT 72

  Fly   104 DDFTALKNLGEKC--------DRLNKKYFKKSDEYAP-QHIRELLQIAASNADGDCDRHVEHFLN 159
            ..:..|:.|.|..        |||..         .| ..:..|||...:..:.:.:...:.||:
Zfish    73 RRYRGLQELYEAYQLRKSTLDDRLGN---------TPLDTLLALLQAEGAKIEEETENLADAFLD 128

  Fly   160 GKTDVQTFLNTYQWSKKISTERKAKEERL 188
            |...:.||::.||..:|::..|:.|.|:|
Zfish   129 GAAPLDTFIDDYQSKRKLAHLRRVKIEKL 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsp37ANP_001259101.1 Mod_r 42..181 CDD:284587 30/147 (20%)
vps37baNP_001093466.1 Mod_r 12..150 CDD:284587 30/146 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3270
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.