DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsp37A and VPS37C

DIOPT Version :9

Sequence 1:NP_001259101.1 Gene:Vsp37A / 31006 FlyBaseID:FBgn0016038 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_060436.4 Gene:VPS37C / 55048 HGNCID:26097 Length:355 Species:Homo sapiens


Alignment Length:148 Identity:41/148 - (27%)
Similarity:70/148 - (47%) Gaps:4/148 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SLDELKQLDRDPEFFEDFIEEMSVVQYLNEELD-SMMDQVEIISRENECKGIHLVELKR-RLSDD 105
            :|.||::|..|.|..:....|...||.|..|.: ::.....:..|..|.:|  .:|:.| .|||.
Human     8 TLQELEELQNDSEAIDQLALESPEVQDLQLEREMALATNRSLAERNLEFQG--PLEISRSNLSDR 70

  Fly   106 FTALKNLGEKCDRLNKKYFKKSDEYAPQHIRELLQIAASNADGDCDRHVEHFLNGKTDVQTFLNT 170
            :..|:.|.|:|.....|..|.|....|..:.:|||:.....:.:.:...|.||.|:..::|||..
Human    71 YQELRKLVERCQEQKAKLEKFSSALQPGTLLDLLQVEGMKIEEESEAMAEKFLEGEVPLETFLEN 135

  Fly   171 YQWSKKISTERKAKEERL 188
            :...:.:|..|:.:.|:|
Human   136 FSSMRMLSHLRRVRVEKL 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsp37ANP_001259101.1 Mod_r 42..181 CDD:284587 38/139 (27%)
VPS37CNP_060436.4 Mod_r 5..146 CDD:284587 38/139 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..355
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3270
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.