DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsp37A and Vps37a

DIOPT Version :9

Sequence 1:NP_001259101.1 Gene:Vsp37A / 31006 FlyBaseID:FBgn0016038 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_291038.2 Gene:Vps37a / 52348 MGIID:1261835 Length:397 Species:Mus musculus


Alignment Length:199 Identity:52/199 - (26%)
Similarity:95/199 - (47%) Gaps:18/199 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PTTPQDLALAHSLAQRPPTDSSEAKEQEAGES-------DNLPNLCTLSLDELKQLDRDPE-FFE 58
            |..| ...:..||....||..|.|...:.|..       |..|.|..||:.:|..::...| ..|
Mouse   191 PVAP-SFGILSSLPLPVPTTESSASVNQNGFGYKMPDIPDAFPELSELSVSQLTDMNEQEEVLLE 254

  Fly    59 DFIEEMSVVQYLNEELDSMMDQVEIISREN---ECKGIHLVELKRR-LSDDFTALKNLGEKCDRL 119
            .|:....:.|.:.::.| ::..:|.::|:|   |    |.:|.||: :.|.:..|..:....::.
Mouse   255 QFLMLPQLKQIITDKED-LVKNIEELARKNLLLE----HSLEGKRQTVLDKYELLLQMKSTFEKK 314

  Fly   120 NKKYFKKSDEYAPQHIRELLQIAASNADGDCDRHVEHFLNGKTDVQTFLNTYQWSKKISTERKAK 184
            .::..:.|:..:...::..|::||..|:.:.|...|.||.|||::..|||:::..:.|...|:||
Mouse   315 MQRQHELSESCSASALQARLKVAAHEAEEESDNIAEDFLEGKTEIDDFLNSFKEKRTICHCRRAK 379

  Fly   185 EERL 188
            ||:|
Mouse   380 EEKL 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsp37ANP_001259101.1 Mod_r 42..181 CDD:284587 34/143 (24%)
Vps37aNP_291038.2 Mod_r 235..376 CDD:284587 34/145 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850017
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3270
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H45120
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008008
OrthoInspector 1 1.000 - - oto94176
orthoMCL 1 0.900 - - OOG6_104152
Panther 1 1.100 - - LDO PTHR13678
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.740

Return to query results.
Submit another query.