DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsp37A and Vps37B

DIOPT Version :9

Sequence 1:NP_001259101.1 Gene:Vsp37A / 31006 FlyBaseID:FBgn0016038 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001246926.1 Gene:Vps37B / 40624 FlyBaseID:FBgn0037299 Length:214 Species:Drosophila melanogaster


Alignment Length:159 Identity:38/159 - (23%)
Similarity:76/159 - (47%) Gaps:11/159 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 DELKQLDRDPEFFEDFIEEMSVVQYLNEELDSMMDQVEIISRENECKGIHLVELKRRLS----DD 105
            :|||:|..|.:..::.::|  |:|.|..:..|:.:.....:..|..:...::||:.:|:    |.
  Fly    19 EELKELLNDDDKLDEKVDE--VLQVLRTQKTSVFEDNRSRAERNIEREPQIIELRGQLAELSEDG 81

  Fly   106 FTALKNLGEKCDRLNKKYFKKSDEYAPQHIRELLQIAASNADGDCDRHVEHFLNGKTDVQTFLNT 170
            .|...::.||..:|.    :||.....:....|||.|||.::...:..|:.|.:....|:.||:.
  Fly    82 RTRCSSVQEKLSQLK----EKSGGVGLETALALLQTAASESEEQTEEMVKKFNDSDIGVEDFLDA 142

  Fly   171 YQWSKKISTERKAKEERLGTQLSALERAG 199
            :...::....|:.|.|:: .:|...:|.|
  Fly   143 FLPIRRTMHLRRLKAEKM-QELMRKQRQG 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsp37ANP_001259101.1 Mod_r 42..181 CDD:284587 32/139 (23%)
Vps37BNP_001246926.1 PABP <16..42 CDD:295409 8/24 (33%)
Mod_r 19..153 CDD:284587 32/139 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470241
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3270
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13678
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.