DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsp37A and Vps37a

DIOPT Version :9

Sequence 1:NP_001259101.1 Gene:Vsp37A / 31006 FlyBaseID:FBgn0016038 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001020038.1 Gene:Vps37a / 290775 RGDID:1560016 Length:398 Species:Rattus norvegicus


Alignment Length:199 Identity:52/199 - (26%)
Similarity:95/199 - (47%) Gaps:18/199 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PTTPQDLALAHSLAQRPPTDSSEAKEQEAGES-------DNLPNLCTLSLDELKQLDRDPE-FFE 58
            |..| ...:..||....||..|.|...:.|..       |..|.|..||:.:|..::...| ..|
  Rat   192 PVAP-SFGILSSLPLPVPTTESSASINQNGFGYKMPDIPDAFPELSELSVSQLTDMNEQEEVLLE 255

  Fly    59 DFIEEMSVVQYLNEELDSMMDQVEIISREN---ECKGIHLVELKRR-LSDDFTALKNLGEKCDRL 119
            .|:....:.|.:.::.| ::..:|.::|:|   |    |.:|.||: :.|.:..|..:....::.
  Rat   256 QFLMLPQLKQIITDKED-LVKSIEELARKNLLLE----HSLETKRQAVLDKYELLIQMKSTFEKK 315

  Fly   120 NKKYFKKSDEYAPQHIRELLQIAASNADGDCDRHVEHFLNGKTDVQTFLNTYQWSKKISTERKAK 184
            .::..:.|:..:...::..|::||..|:.:.|...|.||.|||::..|||:::..:.|...|:||
  Rat   316 MQRQHELSESCSASALQARLKVAAHEAEEESDNIAEDFLEGKTEIDDFLNSFKEKRTICHCRRAK 380

  Fly   185 EERL 188
            ||:|
  Rat   381 EEKL 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsp37ANP_001259101.1 Mod_r 42..181 CDD:284587 34/143 (24%)
Vps37aNP_001020038.1 Mod_r 236..381 CDD:399880 36/149 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353699
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3270
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H45120
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008008
OrthoInspector 1 1.000 - - oto97698
orthoMCL 1 0.900 - - OOG6_104152
Panther 1 1.100 - - LDO PTHR13678
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.740

Return to query results.
Submit another query.