DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsp37A and VPS37D

DIOPT Version :9

Sequence 1:NP_001259101.1 Gene:Vsp37A / 31006 FlyBaseID:FBgn0016038 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001071089.1 Gene:VPS37D / 155382 HGNCID:18287 Length:251 Species:Homo sapiens


Alignment Length:176 Identity:37/176 - (21%)
Similarity:75/176 - (42%) Gaps:3/176 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 AKEQEAGESDNLP-NLCTLSLDELKQLDRDPEFFEDFIEEMSVVQYLNEELDSMMDQVEIISREN 88
            |:...||.....| ....||..:|:.|.:|....:..:......|.|..|.::.:.....:::||
Human     4 ARAARAGPEPGSPGRFGILSTGQLRDLLQDEPKLDRIVRLSRKFQGLQLEREACLASNYALAKEN 68

  Fly    89 ECKGIHLVELKRRLSDDFTALKNLGEKC-DRLNKKYFKKSDEYAPQHIRELLQIAASNADGDCDR 152
            ......|...:..|:..:..|:.:.|.| |:| ::..:....::|......||.....|:.:.:.
Human    69 LALRPRLEMGRAALAIKYQELREVAENCADKL-QRLEESMHRWSPHCALGWLQAELEEAEQEAEE 132

  Fly   153 HVEHFLNGKTDVQTFLNTYQWSKKISTERKAKEERLGTQLSALERA 198
            .:|..|.|:..::.||..:|..:.::..|:.:.|:|...|...||:
Human   133 QMEQLLLGEQSLEAFLPAFQRGRALAHLRRTQAEKLQELLRRRERS 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsp37ANP_001259101.1 Mod_r 42..181 CDD:284587 27/139 (19%)
VPS37DNP_001071089.1 Mod_r 22..165 CDD:399880 28/143 (20%)
pneumo_PspA <138..>248 CDD:411490 11/41 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..251 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3270
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.