DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vsp37A and Vps37c

DIOPT Version :10

Sequence 1:NP_525034.2 Gene:Vsp37A / 31006 FlyBaseID:FBgn0016038 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_852068.1 Gene:Vps37c / 107305 MGIID:2147661 Length:352 Species:Mus musculus


Alignment Length:148 Identity:41/148 - (27%)
Similarity:71/148 - (47%) Gaps:4/148 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SLDELKQLDRDPEFFEDFIEEMSVVQYLNEELDSMMDQVEIISREN-ECKGIHLVELKR-RLSDD 105
            :|.||:::..|||.......|...||.|..|.:..:.....::.:| |.:|  .:|:.| .|||.
Mouse     8 TLQELEEMQNDPEAIARLALESPEVQDLQLEREMALATNRSLAEQNLEFQG--PLEISRSNLSDK 70

  Fly   106 FTALKNLGEKCDRLNKKYFKKSDEYAPQHIRELLQIAASNADGDCDRHVEHFLNGKTDVQTFLNT 170
            :..|:.|.|:|.....|..|.|....|..:.:||||.....:.:.:...|.||.|:..::|||.:
Mouse    71 YQELRKLVERCQEQKAKLEKFSSALQPGTLLDLLQIEGMKIEEESEAMAEKFLEGEVPLETFLES 135

  Fly   171 YQWSKKISTERKAKEERL 188
            :...:.:...|:.:.|:|
Mouse   136 FSSMRTLLHLRRVRVEKL 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vsp37ANP_525034.2 Mod_r 42..185 CDD:462117 39/143 (27%)
Vps37cNP_852068.1 Mod_r 5..149 CDD:462117 39/142 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..352
PHA03247 <184..313 CDD:223021
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.