DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13366 and micall2

DIOPT Version :9

Sequence 1:NP_001036254.1 Gene:CG13366 / 31004 FlyBaseID:FBgn0025633 Length:1094 Species:Drosophila melanogaster
Sequence 2:NP_001072513.1 Gene:micall2 / 779968 XenbaseID:XB-GENE-979747 Length:1023 Species:Xenopus tropicalis


Alignment Length:101 Identity:44/101 - (43%)
Similarity:66/101 - (65%) Gaps:1/101 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   993 ALLKWCQNKTVGYRNIDITNFSSSWNDGLAFCAILHSYLPDRIPYDQLTPANKRRNFSLAFAAA- 1056
            ||.:||:.:..|||::.|||.::|:.||||||||||.:.||.|.:|.|:..|...|..:||:.| 
 Frog     6 ALQQWCKQQCDGYRDVSITNMTTSFRDGLAFCAILHKHRPDLINFDLLSKENVYDNNHMAFSVAE 70

  Fly  1057 ESVGIGTTLNINDMCQIERPDWMQVMSYVTAVYKYF 1092
            |.:||...|:..||.::..||.:.:::||:..|.||
 Frog    71 EKLGIPALLDAEDMVKLRVPDRLSILTYVSQYYNYF 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13366NP_001036254.1 Ead_Ea22 554..684 CDD:290646
CH 992..1092 CDD:237981 42/99 (42%)
micall2NP_001072513.1 CH 5..102 CDD:278723 41/95 (43%)
LIM_Mical_like_1 188..242 CDD:188828
CytochromB561_N 513..>763 CDD:286826
Epiglycanin_TR 601..666 CDD:283334
DUF3585 846..982 CDD:288945
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.