DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13366 and micall2b

DIOPT Version :9

Sequence 1:NP_001036254.1 Gene:CG13366 / 31004 FlyBaseID:FBgn0025633 Length:1094 Species:Drosophila melanogaster
Sequence 2:NP_001299826.1 Gene:micall2b / 556298 ZFINID:ZDB-GENE-030131-5803 Length:783 Species:Danio rerio


Alignment Length:101 Identity:42/101 - (41%)
Similarity:64/101 - (63%) Gaps:1/101 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   993 ALLKWCQNKTVGYRNIDITNFSSSWNDGLAFCAILHSYLPDRIPYDQLTPANKRRNFSLAFAAAE 1057
            ||.:||:.:..|||::.|||.::|:.|||||||::|.:.||.|.:|.|:..|...|...||..||
Zfish     6 ALQQWCKIQCEGYRDVSITNMTTSFRDGLAFCALIHKHRPDLIDFDSLSKENIYENNQRAFEVAE 70

  Fly  1058 -SVGIGTTLNINDMCQIERPDWMQVMSYVTAVYKYF 1092
             .:||...|:..||..::.||.:.:::||:..|.||
Zfish    71 KELGIPALLDAEDMVALKVPDRLSILTYVSQYYNYF 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13366NP_001036254.1 Ead_Ea22 554..684 CDD:290646
CH 992..1092 CDD:237981 40/99 (40%)
micall2bNP_001299826.1 CH 5..102 CDD:278723 39/95 (41%)
LIM_Mical_like_1 179..233 CDD:188828
DUF3585 609..741 CDD:288945
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.