DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13366 and Micall1

DIOPT Version :9

Sequence 1:NP_001036254.1 Gene:CG13366 / 31004 FlyBaseID:FBgn0025633 Length:1094 Species:Drosophila melanogaster
Sequence 2:XP_036015335.1 Gene:Micall1 / 27008 MGIID:105870 Length:887 Species:Mus musculus


Alignment Length:103 Identity:47/103 - (45%)
Similarity:64/103 - (62%) Gaps:1/103 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   991 RNALLKWCQNKTVGYRNIDITNFSSSWNDGLAFCAILHSYLPDRIPYDQLTPANKRRNFSLAFAA 1055
            |.|||.||:.:..|||.:||.:.|||:.||||||||||.:.||.:.:..|:..|...|..|||..
Mouse     5 RGALLAWCRRQCEGYRGVDIRDLSSSFRDGLAFCAILHRHRPDLLDFQSLSKENVFENNRLAFEV 69

  Fly  1056 AE-SVGIGTTLNINDMCQIERPDWMQVMSYVTAVYKYF 1092
            || .:||...|:.|||..:..||.:.:|:||:..|.:|
Mouse    70 AEKELGIPALLDPNDMVSMSVPDCLSIMTYVSQYYNHF 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13366NP_001036254.1 Ead_Ea22 554..684 CDD:290646
CH 992..1092 CDD:237981 45/100 (45%)
Micall1XP_036015335.1 CH_MICALL1 4..110 CDD:409101 47/103 (46%)
LIM_Mical_like_1 165..219 CDD:188828
PHA03247 <287..686 CDD:223021
DUF3585 708..830 CDD:403377
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.