Sequence 1: | NP_001036254.1 | Gene: | CG13366 / 31004 | FlyBaseID: | FBgn0025633 | Length: | 1094 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_003199343.1 | Gene: | smtna / 100333230 | ZFINID: | ZDB-GENE-091204-245 | Length: | 271 | Species: | Danio rerio |
Alignment Length: | 208 | Identity: | 67/208 - (32%) |
---|---|---|---|
Similarity: | 98/208 - (47%) | Gaps: | 40/208 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 900 AGQGTNTSSGSGGDLASTTKATLPLRDQQ-------------QLAITSTQSQVQNVSQPSTPATP 951
Fly 952 SS---AGSSSSGGLPFGNVSKSFISGERKDPLNMLAKNGGSKRNALLKWCQNKTVGYRNIDITNF 1013
Fly 1014 SSSWNDGLAFCAILHSYLPDRIPYDQLTPANKRRNFSLAFAAAESVG-IGTTLNINDMCQIERPD 1077
Fly 1078 WMQVMSYVTAVYK 1090 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG13366 | NP_001036254.1 | Ead_Ea22 | 554..684 | CDD:290646 | |
CH | 992..1092 | CDD:237981 | 40/100 (40%) | ||
smtna | XP_003199343.1 | Smoothelin | 20..59 | CDD:315226 | |
CH | 153..256 | CDD:306753 | 42/113 (37%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |