DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and HDG11

DIOPT Version :10

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_177479.1 Gene:HDG11 / 843671 AraportID:AT1G73360 Length:722 Species:Arabidopsis thaliana


Alignment Length:108 Identity:32/108 - (29%)
Similarity:49/108 - (45%) Gaps:20/108 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   500 GINGAGSGHDDSLNEDGIEEDIDDVDDADGSGGGDANGSDGLPNKKRKRRVLFTKAQTYELERRF 564
            |:.|:|||                   :.|.|||..:......::|:||....|..|...||..|
plant     6 GVGGSGSG-------------------SGGDGGGSHHHDGSETDRKKKRYHRHTAQQIQRLESSF 51

  Fly   565 RQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEK 607
            ::..:....:|..|:..:.|.|.|:|.||||.|.:.| ||:|:
plant    52 KECPHPDEKQRNQLSRELGLAPRQIKFWFQNRRTQLK-AQHER 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeodomain 546..602 CDD:459649 18/55 (33%)
HDG11NP_177479.1 Homeodomain 33..88 CDD:459649 18/54 (33%)
START_ArGLABRA2_like 231..456 CDD:176884
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.