DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and HDG2

DIOPT Version :10

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_172015.1 Gene:HDG2 / 839256 AraportID:AT1G05230 Length:721 Species:Arabidopsis thaliana


Alignment Length:138 Identity:44/138 - (31%)
Similarity:65/138 - (47%) Gaps:27/138 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   485 NNNTTNNNNHSLKAEGINGAGSGHDDSLNEDGIEED-IDDVDDADGS---GGGDANGSDGLPNKK 545
            ||..:||:|::            |:|:.||..:.:| .|..:...||   .||..|..|.|...|
plant    12 NNADSNNHNYN------------HEDNNNEGFLRDDEFDSPNTKSGSENQEGGSGNDQDPLHPNK 64

  Fly   546 RKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTK--------- 601
            :||....|:.|..|:|..|::..:....:|:.|:..:.|.|.|||.||||.|.:.|         
plant    65 KKRYHRHTQLQIQEMEAFFKECPHPDDKQRKQLSRELNLEPLQVKFWFQNKRTQMKNHHERHENS 129

  Fly   602 --RAQNEK 607
              ||:|||
plant   130 HLRAENEK 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeodomain 546..602 CDD:459649 20/66 (30%)
HDG2NP_172015.1 Homeodomain 65..121 CDD:459649 19/55 (35%)
MreC <130..>202 CDD:480808 5/8 (63%)
START_ArGLABRA2_like 246..464 CDD:176884
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.