DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and HB51

DIOPT Version :10

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_195999.2 Gene:HB51 / 831723 AraportID:AT5G03790 Length:235 Species:Arabidopsis thaliana


Alignment Length:75 Identity:24/75 - (32%)
Similarity:39/75 - (52%) Gaps:5/75 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   536 NGSDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKT 600
            |.::.:..|||     .|..|...|||.|:::..|.:..:..|:..:.|.|.|:.:||||.|.:.
plant    70 NNNNEMIKKKR-----LTSGQLASLERSFQEEIKLDSDRKVKLSRELGLQPRQIAVWFQNRRARW 129

  Fly   601 KRAQNEKGYE 610
            |..|.|:.|:
plant   130 KAKQLEQLYD 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeodomain 546..602 CDD:459649 17/55 (31%)
HB51NP_195999.2 Homeodomain 77..130 CDD:459649 19/57 (33%)
HALZ 132..166 CDD:460477 3/8 (38%)

Return to query results.
Submit another query.