DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and HB-3

DIOPT Version :9

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_568309.2 Gene:HB-3 / 831367 AraportID:AT5G15150 Length:314 Species:Arabidopsis thaliana


Alignment Length:254 Identity:59/254 - (23%)
Similarity:82/254 - (32%) Gaps:68/254 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   461 HTLHGSSGN------GSAGGAPTAHALHNNNNNTTNNNNHSLKAEGINGAGSGHDDSLNEDGIEE 519
            |..:|..||      .|..|....|.|...:..||||.|...:.        |.:|:|::|    
plant    54 HLFYGGGGNYMMNRSMSFTGVSDHHHLTQKSPTTTNNMNDQDQV--------GEEDNLSDD---- 106

  Fly   520 DIDDVDDADGSGGGDANGSDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRL 584
                             ||..:..:|:||..|   .|...||:.|.....|....:..||..:.|
plant   107 -----------------GSHMMLGEKKKRLNL---EQVRALEKSFELGNKLEPERKMQLAKALGL 151

  Fly   585 TPTQVKIWFQNHRYKTKRAQNEKGYE-----------------GHPGLLHGH--ATHPHHPSALP 630
            .|.|:.|||||.|.:.|..|.|:.|:                 .|...||..  |...|......
plant   152 QPRQIAIWFQNRRARWKTKQLERDYDSLKKQFDVLKSDNDSLLAHNKKLHAELVALKKHDRKESA 216

  Fly   631 SPRRVAVPVLVRNGKPCLGDSSKLGADC-----------VSVSSATATAMQNAAAHHLV 678
            ..:|........|......:.:...:|.           .|:.|||||.......|.:|
plant   217 KIKREFAEASWSNNGSTENNHNNNSSDANHVSMIKDLFPSSIRSATATTTSTHIDHQIV 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeobox 548..601 CDD:278475 18/52 (35%)
HB-3NP_568309.2 HOX 115..168 CDD:197696 20/55 (36%)
HALZ 170..208 CDD:280364 7/37 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.