DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and FWA

DIOPT Version :10

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_567722.1 Gene:FWA / 828658 AraportID:AT4G25530 Length:686 Species:Arabidopsis thaliana


Alignment Length:115 Identity:35/115 - (30%)
Similarity:50/115 - (43%) Gaps:15/115 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   519 EDIDDVDDADGSGGGDANGSDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIR 583
            ::||.::|..|     .|..||...::..||   |..||.|||..:.:..:.:..:|..|...:.
plant    22 DEIDMINDMSG-----VNDQDGGRMRRTHRR---TAYQTQELENFYMENPHPTEEQRYELGQRLN 78

  Fly   584 LTPTQVKIWFQNHRYKTK----RAQNEKGYEGHPGLLHGHATHPHHPSAL 629
            :...|||.||||.|...|    ..:|....|.|..||   ||.....||:
plant    79 MGVNQVKNWFQNKRNLEKINNDHLENVTLREEHDRLL---ATQDQLRSAM 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeodomain 546..602 CDD:459649 19/59 (32%)
FWANP_567722.1 Homeodomain 40..96 CDD:459649 18/58 (31%)
START_ArGLABRA2_like 211..435 CDD:176884
SRPBCC 479..>632 CDD:472699
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.