DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and NANOG

DIOPT Version :10

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_079141.2 Gene:NANOG / 79923 HGNCID:20857 Length:305 Species:Homo sapiens


Alignment Length:120 Identity:41/120 - (34%)
Similarity:61/120 - (50%) Gaps:10/120 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   521 IDDVDDADGSGGGD---------ANGSDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPERE 576
            |.|..|:..|..|.         |...|.:|.||:|.|.:|:..|...|..||::|:|||..:.:
Human    62 IQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQ 126

  Fly   577 HLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHPGLLHGHATHPHHPSALPS 631
            .|::::.|:..|||.||||.|.|:||.|.....:...|:.. .|:.|.:||...|
Human   127 ELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQ-KASAPTYPSLYSS 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeodomain 546..602 CDD:459649 22/55 (40%)
NANOGNP_079141.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..96 9/33 (27%)
COG5576 74..191 CDD:227863 37/108 (34%)
Homeodomain 97..152 CDD:459649 22/54 (41%)
Required for DNA-binding. /evidence=ECO:0000269|PubMed:25825768 122..151 11/28 (39%)
8 X repeats starting with a Trp in each unit 196..240
Sufficient for transactivation activity. /evidence=ECO:0000250 196..240
Sufficient for strong transactivation activity. /evidence=ECO:0000250 241..305
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.