DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and gsx1

DIOPT Version :10

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_001039254.1 Gene:gsx1 / 734120 XenbaseID:XB-GENE-855502 Length:243 Species:Xenopus tropicalis


Alignment Length:83 Identity:31/83 - (37%)
Similarity:41/83 - (49%) Gaps:6/83 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   539 DGLPNK---KRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKT 600
            |..|::   .::.|..||..|..||||.|....|||...|..:|:.:.|:..||||||||.|.|.
 Frog   128 DSSPSQLSSSKRMRTAFTSTQLLELEREFASNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKH 192

  Fly   601 KRAQNEKGYEGHPGLLHG 618
            |:......:...|   ||
 Frog   193 KKEGKSSTHRASP---HG 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeodomain 546..602 CDD:459649 25/55 (45%)
gsx1NP_001039254.1 homeobox 137..196 26/58 (45%)
Homeodomain 138..194 CDD:459649 25/55 (45%)

Return to query results.
Submit another query.