DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and Nanog

DIOPT Version :10

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_082292.1 Gene:Nanog / 71950 MGIID:1919200 Length:305 Species:Mus musculus


Alignment Length:179 Identity:50/179 - (27%)
Similarity:85/179 - (47%) Gaps:6/179 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   454 LSVG-DALHTLHGSSGNGSAGGAPTAHALHNNNNNT--TNNNNHSLKAEGINGAGSGHDDSL--N 513
            :||| ...|:|..|....::|.|.:..|:.:..|.:  ..:....|..|..:...|..|..|  :
Mouse     1 MSVGLPGPHSLPSSEEASNSGNASSMPAVFHPENYSCLQGSATEMLCTEAASPRPSSEDLPLQGS 65

  Fly   514 EDGIEEDIDDVDDADGSGGGDANGSDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHL 578
            .|........:...:...|.:...:..|. :|:|.|.:|::||...|:.||::|:|||..:.:.|
Mouse    66 PDSSTSPKQKLSSPEADKGPEEEENKVLA-RKQKMRTVFSQAQLCALKDRFQKQKYLSLQQMQEL 129

  Fly   579 ASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHPGLLHGHATHPHHPS 627
            :|::.|:..|||.||||.|.|.||.|..:..:...||:...:....:||
Mouse   130 SSILNLSYKQVKTWFQNQRMKCKRWQKNQWLKTSNGLIQKGSAPVEYPS 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeodomain 546..602 CDD:459649 24/55 (44%)
NanogNP_082292.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 9/28 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..95 8/49 (16%)
Sufficient for interaction with SALL4. /evidence=ECO:0000269|PubMed:16840789 96..155 27/58 (47%)
Homeodomain 98..153 CDD:459649 24/54 (44%)
Required for DNA-binding. /evidence=ECO:0000250|UniProtKB:Q9H9S0 123..152 12/28 (43%)
PTZ00395 <190..>250 CDD:185594
10 X repeats starting with a Trp in each unit 198..247
Sufficient for transactivation activity 198..247
Sufficient for strong transactivation activity 248..305
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.