DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and NKX2-1

DIOPT Version :9

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_001073136.1 Gene:NKX2-1 / 7080 HGNCID:11825 Length:401 Species:Homo sapiens


Alignment Length:509 Identity:149/509 - (29%)
Similarity:183/509 - (35%) Gaps:182/509 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 SGHRGQ--------GSHTSPSALS-----------PTPAGVS-----ADEHHNGSG-TGGGAGEA 279
            ||..|:        |..:||..||           .||..||     .:|.:...| .|||.|..
Human     3 SGGSGKARGWEAAAGGRSSPGRLSRRRIMSMSPKHTTPFSVSDILSPLEESYKKVGMEGGGLGAP 67

  Fly   280 DHHSTTEHHAPPSHPQQQHPHHQQHHHPHLLLPQQHHQQAVAPLPLAHHQSGEAQSHAHANAAAA 344
            .........|||:...|||                         .:.||  |...:..|..||..
Human    68 LAAYRQGQAAPPTAAMQQH-------------------------AVGHH--GAVTAAYHMTAAGV 105

  Fly   345 HLLASHNAAAAAAVAAGQYLPNLPKNFPGSFGDEMSSYHHMAQTMLQHSGRSAWIKENELYGTQQ 409
            ..| ||:       |.|.|.       .|:.|: ||.......||...:....|      ||   
Human   106 PQL-SHS-------AVGGYC-------NGNLGN-MSELPPYQDTMRNSASGPGW------YG--- 145

  Fly   410 PASPDSTSPVTSEVSYTYIGSNCQTSPALSGDYKSYSRSADSDALSVGDALHTLHGSSGNGSAGG 474
             |:||...|..|.    ::|                                             
Human   146 -ANPDPRFPAISR----FMG--------------------------------------------- 160

  Fly   475 APTAHALHNNNNNTTNNNNHSLKAEGINGAGSGHDDSLNEDGIEEDIDDVDDADGSGGGDANGSD 539
                                  .|.|:|.:|.|        |:           ||.|..:....
Human   161 ----------------------PASGMNMSGMG--------GL-----------GSLGDVSKNMA 184

  Fly   540 GLPN-KKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRA 603
            .||: .:|||||||::||.|||||||:||:||||||||||||:|.||||||||||||||||.||.
Human   185 PLPSAPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQ 249

  Fly   604 QNEKGYE-------GHPGLLHGHATHPHHPSALPSPRRVAVPVLVRNGKPCLGDSSKLGADCVSV 661
            ..:|..:       |..|...|........:...|||||||||||::||||     :.||.....
Human   250 AKDKAAQQQLQQDSGGGGGGGGTGCPQQQQAQQQSPRRVAVPVLVKDGKPC-----QAGAPAPGA 309

  Fly   662 SSATATAMQNAAAHHLVALNGAAAYQHAAAAAAGLHAHAHAHAHAHGHGHPHAH 715
            :|....|.|. |.|...|...|||.....:..|||.||......:.|.....||
Human   310 ASLQGHAQQQ-AQHQAQAAQAAAAAISVGSGGAGLGAHPGHQPGSAGQSPDLAH 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeobox 548..601 CDD:278475 45/52 (87%)
NKX2-1NP_001073136.1 Homeobox 194..247 CDD:278475 45/52 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X524
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.