DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and lbx2

DIOPT Version :10

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_001007135.1 Gene:lbx2 / 64276 ZFINID:ZDB-GENE-001206-2 Length:257 Species:Danio rerio


Alignment Length:231 Identity:66/231 - (28%)
Similarity:91/231 - (39%) Gaps:51/231 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   380 SSYHHMAQTMLQHSGRSAWIKENELYG--TQQPASPDSTSPVTSEVSYTYIGSNCQTSPALSGDY 442
            ||....|.::||.||      |....|  .|.|...:|..|:|     .:...:....|      
Zfish     4 SSKDMKAGSVLQSSG------EERRRGPLDQLPPPANSNKPLT-----PFSIEDILNKP------ 51

  Fly   443 KSYSRSADSDALSVGDALHTLHGSSGNGSAGGAPTAH--ALHNNNNNTTNNNNHSLKAEGINGAG 505
             |..:|..|  |.....|..:.|||.:.:...||::.  ||....:.|..               
Zfish    52 -SVKKSVGS--LCPPRVLEKVTGSSASRNGISAPSSPLCALEELASKTFK--------------- 98

  Fly   506 SGHDDSLNEDGIEEDIDDVDDADGSGGGDANGSDGLPNKKRKRRVLFTKAQTYELERRFRQQRYL 570
                      |:|..:  :..|:|....:|.|......|:||.|..||..|.||||:||..|:||
Zfish    99 ----------GLEVSV--IQAAEGREHINAFGQRQASKKRRKSRTAFTNHQIYELEKRFLYQKYL 151

  Fly   571 SAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNE 606
            |..:|:.:|..:.||..||..||||.|.|.||...|
Zfish   152 SPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEE 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeodomain 546..602 CDD:459649 28/55 (51%)
lbx2NP_001007135.1 Required for convergent extension movement and hypaxial myogenesis during gastrulation. Required for the formation of thick and thin myofilaments. Required for myod1 expression in the pectoral fin bud. Required for continuous expression of cxcl12a in the posterior lateral mesoderm at the tail bud stage and in adaxial cells at the 10-somite stage. /evidence=ECO:0000269|PubMed:19216761, ECO:0000269|PubMed:22216300, ECO:0000269|PubMed:22406073 1..46 14/52 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 14/49 (29%)
Homeodomain 127..183 CDD:459649 28/55 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 206..257
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.