DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and bsx

DIOPT Version :10

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_999892.1 Gene:bsx / 573364 ZFINID:ZDB-GENE-040628-4 Length:227 Species:Danio rerio


Alignment Length:65 Identity:34/65 - (52%)
Similarity:43/65 - (66%) Gaps:3/65 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   541 LPNK---KRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKR 602
            ||.|   :||.|.:|:.:|...||:||..|||||.|||..||:.:.|:.||||.||||.|.|.|:
Zfish    98 LPGKHCRRRKARTVFSDSQLSGLEKRFEIQRYLSTPERVELATALSLSETQVKTWFQNRRMKHKK 162

  Fly   603  602
            Zfish   163  162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeodomain 546..602 CDD:459649 30/55 (55%)
bsxNP_999892.1 Homeodomain 106..162 CDD:459649 30/55 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..227 3/6 (50%)

Return to query results.
Submit another query.