DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and nkx2.4a

DIOPT Version :9

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_001104636.1 Gene:nkx2.4a / 562300 ZFINID:ZDB-GENE-030131-6336 Length:345 Species:Danio rerio


Alignment Length:355 Identity:112/355 - (31%)
Similarity:160/355 - (45%) Gaps:93/355 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   373 GSFGDEMSSYH--HMAQT-MLQHS-GRSAWIKENELYGTQQPASPDSTSPVTSEVSYTYIGSNCQ 433
            |:....:.:|.  .::|| |.||| |.:|.:...    ...|.|       .|:.|::.:|..|.
Zfish    34 GNLTSPLGAYRQPQVSQTGMQQHSMGHNATVATT----YHMPHS-------VSQFSHSAMGGYCN 87

  Fly   434 TSPALSGDYKSYSRSADSDALSVGDALHTLHGSSGNGSAGGAPTAHALHNNNNNTTNNNNHSLKA 498
            .|.|..||..||..:..:.|.:.|     .:|::.:      |....:......:|         
Zfish    88 GSIANMGDLPSYQETMRNSAAATG-----WYGANPD------PRYSTISRFMGPST--------- 132

  Fly   499 EGINGAGSGHDDSLNEDGIEEDIDDVDDADGSGGGDANGSDGLP----NKKRKRRVLFTKAQTYE 559
             |:|..|.|   :|.                   |.|:.:..:|    ..:|||||||::||..|
Zfish   133 -GMNMTGMG---TLT-------------------GMADTTKSIPPLHAAPRRKRRVLFSQAQVCE 174

  Fly   560 LERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKG-----YEGHPGLLHGH 619
            |||||:||:||||||||||||:|.||||||||||||||||.||...:|.     .||:  |....
Zfish   175 LERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQLQQEGN--LCQQQ 237

  Fly   620 ATHPHHPSALPSPRRVAVPVLVRNGKPCLGDSS------------KLGADCVSVSSATATAMQNA 672
                      .|||||||||||::||||...|:            :.|...|..:|  :.:|...
Zfish   238 ----------QSPRRVAVPVLVKDGKPCQNGSNTPTPNQQQMQQQQNGGGVVLPTS--SNSMNQH 290

  Fly   673 AAHHLVALNGAAAYQHAAAAAAGLHAHAHA 702
            .:..:.||..|...:..:.:...||:..::
Zfish   291 QSQQVNALVQAQDLEEMSPSPPSLHSQMNS 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeobox 548..601 CDD:278475 44/52 (85%)
nkx2.4aNP_001104636.1 Homeobox 163..216 CDD:278475 44/52 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X524
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.