DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and meox2a

DIOPT Version :9

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:XP_017206696.1 Gene:meox2a / 556898 ZFINID:ZDB-GENE-080613-1 Length:302 Species:Danio rerio


Alignment Length:398 Identity:89/398 - (22%)
Similarity:116/398 - (29%) Gaps:165/398 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 AAAAAAHHGSDLSHHSASESTSGHRGQGSHTSPSALSPTPAGVSADEHHNGSGTGGGAGEADHHS 283
            |...|.|....|  |...|..|.:....|.:.||...     ||.....:|...||         
Zfish    14 APPQAVHPAFAL--HGRPEHLSSYPDLSSSSPPSTCI-----VSGYPGEDGGLFGG--------- 62

  Fly   284 TTEHHAPPSHPQQQHPHHQQHHHPHLLLPQQHHQQAVAPLPLAHHQSGEAQSHAHANAAAAHLLA 348
               |....|..||||.||..|||    |.||                                  
Zfish    63 ---HQRGLSVSQQQHHHHHHHHH----LAQQ---------------------------------- 86

  Fly   349 SHNAAAAAAVAAGQYLPNLPKNFPGSFGDEMSSYHHMAQTMLQHSGRSAWIKENELYGTQQPASP 413
                       .|.:||......|.:.|..:.         |..||                  |
Zfish    87 -----------GGWHLPQSSSASPSAAGVRLG---------LGISG------------------P 113

  Fly   414 DSTSPVTSEVSYTYIG----SNCQTSPALSGDYKSYSRSADSDALSVGD-ALHTLHGSSGNGSAG 473
            ||.|        :.:|    |.|.::|:|.....|     .:..:..|| ..||:          
Zfish   114 DSGS--------SDVGPGGPSLCASTPSLGAGVPS-----GASCVPGGDFGRHTM---------- 155

  Fly   474 GAPTAHALHNNNNNTTNNNNHSLKAEGINGAGSGHDDSLNEDGIEEDIDDVDDADGSGGGDANGS 538
             :|......|:...:                    |.|.::||                   |..
Zfish   156 -SPAEAEKRNSKRRS--------------------DSSESQDG-------------------NYK 180

  Fly   539 DGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRA 603
            ..:.:|.||.|..|||.|..|||..|....||:...|..:|..:.||..|||:||||.|.|.||.
Zfish   181 SDVSSKPRKERTAFTKEQIRELEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMKWKRV 245

  Fly   604 QNEKGYEG 611
            :.  |.:|
Zfish   246 KG--GQQG 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeobox 548..601 CDD:278475 24/52 (46%)
meox2aXP_017206696.1 COG5576 161..267 CDD:227863 37/132 (28%)
Homeobox 191..243 CDD:278475 24/51 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I5027
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.