| Sequence 1: | NP_476786.2 | Gene: | vnd / 31003 | FlyBaseID: | FBgn0261930 | Length: | 723 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001016678.1 | Gene: | hoxd1 / 549432 | XenbaseID: | XB-GENE-482731 | Length: | 301 | Species: | Xenopus tropicalis |
| Alignment Length: | 140 | Identity: | 25/140 - (17%) |
|---|---|---|---|
| Similarity: | 50/140 - (35%) | Gaps: | 42/140 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 98 SYSKCFNESSYQMIFLNNCLFFINEYARRCSTWLLFSVAVIRTLVIRNPMSPKYAKLSNSSTALR 162
Fly 163 VIFG--------------VSIICIIF--------SINTALEN------EIEIIDRK-------PS 192
Fly 193 ECNSKGVISY 202 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| vnd | NP_476786.2 | Homeodomain | 546..602 | CDD:459649 | |
| hoxd1 | NP_001016678.1 | Antp-type hexapeptide. /evidence=ECO:0000255 | 178..183 | ||
| Homeodomain | 207..260 | CDD:459649 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 255..301 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||