DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and hoxd1

DIOPT Version :10

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_001016678.1 Gene:hoxd1 / 549432 XenbaseID:XB-GENE-482731 Length:301 Species:Xenopus tropicalis


Alignment Length:140 Identity:25/140 - (17%)
Similarity:50/140 - (35%) Gaps:42/140 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 SYSKCFNESSYQMIFLNNCLFFINEYARRCSTWLLFSVAVIRTLVIRNPMSPKYAKLSNSSTALR 162
            |.:|..||::.:.       :.:.:..|..|.|::.....:..|:..:|.:...|...:..::..
 Frog    26 SLAKYNNENTSKQ-------YSLFKVTRASSQWVVGPSYFVEYLIKESPCTKSQASSCSLQSSDS 83

  Fly   163 VIFG--------------VSIICIIF--------SINTALEN------EIEIIDRK-------PS 192
            |..|              ||:.|..|        |.|:|:..      ::|...:|       ||
 Frog    84 VPVGLCKGSLTRTHWEKFVSVTCDFFESQAPATGSENSAVNQKPTNLPKVEESQQKNTPPTDSPS 148

  Fly   193 ECNSKGVISY 202
            :...:|.:.|
 Frog   149 KAGPRGSVQY 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeodomain 546..602 CDD:459649
hoxd1NP_001016678.1 Antp-type hexapeptide. /evidence=ECO:0000255 178..183
Homeodomain 207..260 CDD:459649
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 255..301
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.