DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and nkx2.2b

DIOPT Version :9

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_001007783.2 Gene:nkx2.2b / 493627 ZFINID:ZDB-GENE-050217-3 Length:237 Species:Danio rerio


Alignment Length:263 Identity:99/263 - (37%)
Similarity:129/263 - (49%) Gaps:72/263 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   484 NNNNTTNNNNHSLKAEGIN----------------GAGSGH--------DDSLNEDGIEEDIDDV 524
            |:..:.:.:....:.||:|                |:..||        .:.||.:...::..|.
Zfish    22 NDEGSVSEDTEDEQDEGLNANQKKQHDSSRDALWLGSSCGHKYPVPSASPEELNPELSADESVDR 86

  Fly   525 DDADGSGGGDANGSDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQV 589
            :.::.||            ||||||:||:|.||:|||||||||||||||||||||.|:.||||||
Zfish    87 ESSEDSG------------KKRKRRILFSKTQTFELERRFRQQRYLSAPEREHLAKLLHLTPTQV 139

  Fly   590 KIWFQNHRYKTKRAQNEKGYEGHPGLLHGHATHPHHPSALPSPRRVAVPVLVRNGKPCLGDSSKL 654
            ||||||||||.|||:.|||.:  |.||              |||||::|||||:|:||    ..|
Zfish   140 KIWFQNHRYKVKRARAEKGLD--PYLL--------------SPRRVSIPVLVRDGRPC----HLL 184

  Fly   655 GADCVSVSSATATAMQNAAAHHLVALNGAAAYQ-HAAAAAAGLHAHAHAHAHAHGHGHPHAHAQR 718
            |...::.|...|||       ...|.|.....| |        |:|.:...|.....:...|.|.
Zfish   185 GPQDITASIPPATA-------PFTAFNMKPFPQIH--------HSHNNIVTHLTSSVNHLGHMQP 234

  Fly   719 AAW 721
            .:|
Zfish   235 WSW 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeobox 548..601 CDD:278475 45/52 (87%)
nkx2.2bNP_001007783.2 Homeobox 98..151 CDD:278475 45/52 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072653at2759
OrthoFinder 1 1.000 - - FOG0002404
OrthoInspector 1 1.000 - - otm25708
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24340
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2570
SonicParanoid 1 1.000 - - X524
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
88.050

Return to query results.
Submit another query.