DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and NKX2-2

DIOPT Version :9

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_002500.1 Gene:NKX2-2 / 4821 HGNCID:7835 Length:273 Species:Homo sapiens


Alignment Length:281 Identity:117/281 - (41%)
Similarity:140/281 - (49%) Gaps:77/281 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   465 GSSGNGSAGGA---PTAHALHNNNNN-------TTNNNNHSLKAEGINGAGSGHDDSLN---EDG 516
            |..|.|:....   |..:..:::::|       :|....:||  .|: .||:...||.:   |..
Human    46 GPLGQGALDAVQSLPLKNPFYDSSDNPYTRWLASTEGLQYSL--HGL-AAGAPPQDSSSKSPEPS 107

  Fly   517 IEEDIDDVDDADGSGGGDANGSDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASL 581
            .:|..|:..:..| |||||       .|||||||||:||||||||||||||||||||||||||||
Human   108 ADESPDNDKETPG-GGGDA-------GKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASL 164

  Fly   582 IRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHPGLLHGHATHPHHPSALPSPRRVAVPVLVRNGKP 646
            ||||||||||||||||||.|||:.|||.|..|               ||||||||||||||:|||
Human   165 IRLTPTQVKIWFQNHRYKMKRARAEKGMEVTP---------------LPSPRRVAVPVLVRDGKP 214

  Fly   647 CLGDSSKLGADCVSVSSATATAMQNAAAHHLVALNGAAAYQHAAAAAAGLHAHAHAHAHAHGH-- 709
            |                           |.|.|.:.|||...|....:...|.:..|...:..  
Human   215 C---------------------------HALKAQDLAAATFQAGIPFSAYSAQSLQHMQYNAQYS 252

  Fly   710 ---------GHPHAHAQRAAW 721
                     .||...||:..|
Human   253 SASTPQYPTAHPLVQAQQWTW 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeobox 548..601 CDD:278475 51/52 (98%)
NKX2-2NP_002500.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56 3/9 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..131 16/49 (33%)
Homeobox 131..185 CDD:395001 51/53 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 115 1.000 Domainoid score I6058
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072653at2759
OrthoFinder 1 1.000 - - FOG0002404
OrthoInspector 1 1.000 - - oto89156
orthoMCL 1 0.900 - - OOG6_108087
Panther 1 1.100 - - O PTHR24340
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2570
SonicParanoid 1 1.000 - - X524
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.810

Return to query results.
Submit another query.