DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and meox1

DIOPT Version :9

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_001002450.2 Gene:meox1 / 436723 ZFINID:ZDB-GENE-040718-149 Length:253 Species:Danio rerio


Alignment Length:321 Identity:76/321 - (23%)
Similarity:98/321 - (30%) Gaps:107/321 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 QHHQQAVAPLPLAHHQSGEAQSHAHANAAAAHLLASHNAAAAAAVAAGQYLPNLPKNFPGSFGDE 378
            |.:|||    |.|.||..:             .||..:.:::..|.|....|...:.:|.:    
Zfish    35 QPYQQA----PFALHQKHD-------------FLAYTDFSSSCLVPAPHAYPREDRLYPET---- 78

  Fly   379 MSSYHHMAQTMLQHSG--RSAW-IKENELYGTQQPASPDSTSPVTSEVSYTYIGSNCQTSPALSG 440
                         |||  |:.| ....|..|..|.....:...|.:|:.                
Zfish    79 -------------HSGYQRTEWQFSPCEPRGRGQEPCQGAAEAVGAEMD---------------- 114

  Fly   441 DYKSYSRSADSDALSVGDALHTLHGSSGNGSAGGAPTAHALHNNNNNTTNNNNHSLKAEGINGAG 505
                   ||..|.|: |.....|.|.....|.....|...........|:..:.|.||       
Zfish   115 -------SAGGDRLA-GAVTGCLEGDYSPQSVPAVDTEKKSSKRKREVTDIQDSSFKA------- 164

  Fly   506 SGHDDSLNEDGIEEDIDDVDDADGSGGGDANGSDGLPNKKRKRRVLFTKAQTYELERRFRQQRYL 570
                                        |:|      .|.||.|..|||.|..|||..|....||
Zfish   165 ----------------------------DSN------CKARKERTAFTKEQLRELEAEFTHHNYL 195

  Fly   571 SAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEGHPGLLHGHATHPHHPSALPS 631
            :...|..:|..:.||..|||:||||.|.|.||.   ||  |.|...|.........:|.||
Zfish   196 TRLRRYEIAVNLDLTERQVKVWFQNRRMKWKRV---KG--GQPASPHDLEADELDSAASPS 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeobox 548..601 CDD:278475 24/52 (46%)
meox1NP_001002450.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..158 3/21 (14%)
Homeobox 174..226 CDD:278475 24/51 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 226..253 10/31 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I5027
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.