DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and CG15696

DIOPT Version :10

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster


Alignment Length:69 Identity:29/69 - (42%)
Similarity:40/69 - (57%) Gaps:3/69 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   542 PNKK---RKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRA 603
            |.|:   |..|:.||..|...||..:::..||||.:...||..:.||.|:|||||||.|.:.:|.
  Fly    88 PAKRTPGRLPRIPFTPQQLQALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQNRRARERRE 152

  Fly   604 QNEK 607
            :.||
  Fly   153 KREK 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeodomain 546..602 CDD:459649 24/55 (44%)
CG15696NP_650921.1 Homeodomain 95..144 CDD:459649 21/48 (44%)

Return to query results.
Submit another query.