| Sequence 1: | NP_476786.2 | Gene: | vnd / 31003 | FlyBaseID: | FBgn0261930 | Length: | 723 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_647677.2 | Gene: | Dbx / 38254 | FlyBaseID: | FBgn0261723 | Length: | 741 | Species: | Drosophila melanogaster |
| Alignment Length: | 139 | Identity: | 26/139 - (18%) |
|---|---|---|---|
| Similarity: | 49/139 - (35%) | Gaps: | 53/139 - (38%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 11 FYPNFQNKTAISLCQFQFKLIEIVSQISAYEYI-ASCVCFLINVVHILVLTRKSMRTSSINVI-- 72
Fly 73 ---MTAVAI----------FDICSYLLNFG----------------------------TLAVRII 96
Fly 97 SSYSKCFNE 105 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| vnd | NP_476786.2 | Homeodomain | 546..602 | CDD:459649 | |
| Dbx | NP_647677.2 | Homeodomain | 437..491 | CDD:459649 | 3/6 (50%) |
| Blue background indicates that the domain is not in the aligned region. | |||||