DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and Dbx

DIOPT Version :10

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_647677.2 Gene:Dbx / 38254 FlyBaseID:FBgn0261723 Length:741 Species:Drosophila melanogaster


Alignment Length:139 Identity:26/139 - (18%)
Similarity:49/139 - (35%) Gaps:53/139 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FYPNFQNKTAISLCQFQFKLIEIVSQISAYEYI-ASCVCFLINVVHILVLTRKSMRTSSINVI-- 72
            |..||...::..:.|: ::||.:  ....|:.: .:|      :.:::||.....:|...|::  
  Fly   313 FTLNFSKGSSQIIAQY-YQLIRL--GFEGYKNVMENC------IENMVVLKEGIEKTERFNIVSK 368

  Fly    73 ---MTAVAI----------FDICSYLLNFG----------------------------TLAVRII 96
               :..||.          |:|...|..||                            |||.|::
  Fly   369 DQGVPVVAFSLKDHSFHNEFEISEMLRRFGWIVPAYTMPADAQHITVLRVVIREDFSRTLAERLV 433

  Fly    97 SSYSKCFNE 105
            :..||..:|
  Fly   434 ADISKVLHE 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeodomain 546..602 CDD:459649
DbxNP_647677.2 Homeodomain 437..491 CDD:459649 3/6 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.