DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and Nkx2-2

DIOPT Version :9

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_001178833.1 Gene:Nkx2-2 / 366214 RGDID:1308443 Length:273 Species:Rattus norvegicus


Alignment Length:277 Identity:114/277 - (41%)
Similarity:135/277 - (48%) Gaps:72/277 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   465 GSSGNGSAGGAPTAHALHNNNNN-------TTNNNNHSLKAEGINGAGSGHDDSLN--EDGIEED 520
            |.|...:....|.....:::::|       :|....:||  .|:..:....|.|..  |...:|.
  Rat    49 GQSALDAVQSLPLKSPFYDSSDNPYTRWLASTEGLQYSL--HGLAASAPPQDSSSKSPEPSADES 111

  Fly   521 IDDVDDADGSGGGDANGSDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLT 585
            .|:..:..| |||||       .|||||||||:||||||||||||||||||||||||||||||||
  Rat   112 PDNDKETQG-GGGDA-------GKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLT 168

  Fly   586 PTQVKIWFQNHRYKTKRAQNEKGYEGHPGLLHGHATHPHHPSALPSPRRVAVPVLVRNGKPCLGD 650
            ||||||||||||||.|||:.|||.|..|               ||||||||||||||:||||   
  Rat   169 PTQVKIWFQNHRYKMKRARAEKGMEVTP---------------LPSPRRVAVPVLVRDGKPC--- 215

  Fly   651 SSKLGADCVSVSSATATAMQNAAAHHLVALNGAAAYQHAAAAAAGLHAHAHAHAHAHGH------ 709
                                    |.|.|.:.|||...|....:...|.:..|...:..      
  Rat   216 ------------------------HALKAQDLAAATFQAGIPFSAYSAQSLQHMQYNAQYSSAST 256

  Fly   710 -----GHPHAHAQRAAW 721
                 .||...||:..|
  Rat   257 PQYPTAHPLVQAQQWTW 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeobox 548..601 CDD:278475 51/52 (98%)
Nkx2-2NP_001178833.1 Homeobox 131..185 CDD:395001 51/53 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 115 1.000 Domainoid score I5895
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072653at2759
OrthoFinder 1 1.000 - - FOG0002404
OrthoInspector 1 1.000 - - oto96283
orthoMCL 1 0.900 - - OOG6_108087
Panther 1 1.100 - - O PTHR24340
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X524
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.780

Return to query results.
Submit another query.