DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and Nkx2-4

DIOPT Version :9

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:XP_038962557.1 Gene:Nkx2-4 / 366213 RGDID:1304985 Length:353 Species:Rattus norvegicus


Alignment Length:417 Identity:131/417 - (31%)
Similarity:166/417 - (39%) Gaps:154/417 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 HTSPSALSPTPAGVSADEHHNGS-------GTGGGAGEADHHSTTEHHAPPSHPQQQHPHHQQHH 305
            ||:|.::|...:.:.......|.       |.|...|.|      .:.|||:.|..|        
  Rat     7 HTTPFSVSDILSPIEETYKKFGGVMDGAPPGLGAPLGAA------AYRAPPTGPSSQ-------- 57

  Fly   306 HPHLLLPQQHHQQAVAPLPLAHHQSGEAQSHAHANAAAAHLLASHNAAAAAAVAAGQYLPNLPKN 370
                       ..|||.:...|..:|    |..|.||||       ||||||.||..::|     
  Rat    58 -----------AAAVAGMQPPHAMAG----HNAAAAAAA-------AAAAAAAAATYHMP----- 95

  Fly   371 FPGSFGDEMSSYHHMAQTMLQHSGRSAWIKENELYGTQQPASPDSTSPVTSEVSYTYIGSNCQTS 435
             ||     :|.:.|.|                                         :||.|...
  Rat    96 -PG-----VSQFPHSA-----------------------------------------MGSYCNGG 113

  Fly   436 PALSGDYKSYSRSADSDALSVGDALHTLHGSSGNGSAGGAPTAHALHNNNNNTTNNNNHSLKAEG 500
            ....|:..:|:           |.:        .|.|..|.|.....|.:...::.:.....:.|
  Rat   114 LGNMGELPAYT-----------DGM--------RGGAAAAATGWYGANTDPRYSSISRFMGPSAG 159

  Fly   501 INGAGSGHDDSLNEDGIEEDIDDVDDADGSGGGDANGSDGL-----PNKKRKRRVLFTKAQTYEL 560
            :|.||.|   ||.                   |.|:.:..|     ...:|||||||::||.|||
  Rat   160 VNVAGMG---SLT-------------------GIADAAKSLAPLHAAAPRRKRRVLFSQAQVYEL 202

  Fly   561 ERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKG-----YEGHPGLLHGHA 620
            ||||:||:||||||||||||:|.||||||||||||||||.||...:|.     .||..|      
  Rat   203 ERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKAAQQLQQEGGLG------ 261

  Fly   621 THPHHPSALPSPRRVAVPVLVRNGKPC 647
              |..|...||||||||||||::||||
  Rat   262 --PPPPPPPPSPRRVAVPVLVKDGKPC 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeobox 548..601 CDD:278475 45/52 (87%)
Nkx2-4XP_038962557.1 Homeobox 190..244 CDD:395001 45/53 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X524
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.