DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and Nkx2-6

DIOPT Version :9

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_001121125.1 Gene:Nkx2-6 / 364418 RGDID:1306149 Length:213 Species:Rattus norvegicus


Alignment Length:147 Identity:68/147 - (46%)
Similarity:87/147 - (59%) Gaps:32/147 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   507 GHDDSLNEDGIEEDIDDVDDADGSGGGDANGSDGLP---NKKRKRRVLFTKAQTYELERRFRQQR 568
            |.::.:.|.|:           |:...|...:..:|   ..:||.||||::||...|||||:|||
  Rat    20 GVENLMMEHGV-----------GNRSDDPRRAGPVPTVTRPRRKPRVLFSQAQVLALERRFKQQR 73

  Fly   569 YLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYE--GHPGLLHGHATHPHHPSALPS 631
            ||||||||||||:::||.|||||||||.|||.||.:.::..|  |||                .:
  Rat    74 YLSAPEREHLASVLQLTSTQVKIWFQNRRYKCKRQRQDQTLELAGHP----------------LA 122

  Fly   632 PRRVAVPVLVRNGKPCL 648
            ||||||||||.:.||||
  Rat   123 PRRVAVPVLVLDVKPCL 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeobox 548..601 CDD:278475 40/52 (77%)
Nkx2-6NP_001121125.1 Homeobox 53..107 CDD:395001 40/53 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336899
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.