DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and en

DIOPT Version :10

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_523700.2 Gene:en / 36240 FlyBaseID:FBgn0000577 Length:552 Species:Drosophila melanogaster


Alignment Length:34 Identity:11/34 - (32%)
Similarity:20/34 - (58%) Gaps:5/34 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 LFPIITIILINELR-RIDVKRKSSTSSNKAKDSQ 268
            ||| :|||.:|:.. |.:   :::|.|.:.|..:
  Fly    45 LFP-LTIIHLNDFHARFE---ETNTVSTRCKPDE 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeodomain 546..602 CDD:459649
enNP_523700.2 Homeodomain 455..511 CDD:459649
Engrail_1_C_sig 512..542 CDD:431338
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.