DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and Nkx2-3

DIOPT Version :9

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_001101064.1 Gene:Nkx2-3 / 309389 RGDID:1308521 Length:362 Species:Rattus norvegicus


Alignment Length:340 Identity:115/340 - (33%)
Similarity:169/340 - (49%) Gaps:73/340 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   417 SPVTS-----------EVSYTYIGSNCQ--------TSPAL--SGDYKSYSRSADSDALSVGDA- 459
            |||||           |....:.|::.|        ::|.:  :.:...:|.:.:.|....|:. 
  Rat     5 SPVTSTPFSVKDILNLEQQRHFHGAHLQAELEQHLHSAPCMLAAAEGTQFSDAGEEDEEEEGEKL 69

  Fly   460 --LHTLHGSSGNGSAGGAPTAHALHNNNNNTTNNNNHSLKAEGINGAGSGHDDSLNEDG-----I 517
              |::|..:.|:|.:|..|.::.             |::..:..:|.....::.::|..     :
  Rat    70 SYLNSLAAAEGHGVSGLCPQSYV-------------HTVLRDSCSGPKEQEEEVVSERSQKSCQL 121

  Fly   518 EEDIDDVDDADGSGGGDANGSDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLI 582
            ::.::...|...|    .:|....|..:||.||||::||.:||||||:|||||||||||||||.:
  Rat   122 KKSLEAAGDCKAS----EDGERPKPRSRRKPRVLFSQAQVFELERRFKQQRYLSAPEREHLASSL 182

  Fly   583 RLTPTQVKIWFQNHRYKTKRAQNEKGYEGHPGLLHGHATHPHHPSALPSPRRVAVPVLVRNGKPC 647
            :||.|||||||||.|||.||.:.:|..|     |..||..       |.|||||||||||:||||
  Rat   183 KLTSTQVKIWFQNRRYKCKRQRQDKSLE-----LGTHAPP-------PPPRRVAVPVLVRDGKPC 235

  Fly   648 LGDSSK-------LGADCVSVSSATATAMQNAAAHHLVALNGAAAYQHAAAAAAGLHAHAHAHAH 705
            :..|::       :||...|.:|..|....|:||        |||...||||||..::.::..|:
  Rat   236 VTPSAQAYGSPYGVGAGAYSYNSFPAYGYGNSAA--------AAAAAAAAAAAAAAYSGSYGCAY 292

  Fly   706 AHGHGHPHAHAQRAA 720
            ..|.|.....|..||
  Rat   293 PTGGGGGGGGAASAA 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeobox 548..601 CDD:278475 41/52 (79%)
Nkx2-3NP_001101064.1 Homeobox 148..202 CDD:395001 41/53 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I11893
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.