DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and nkx2.2a

DIOPT Version :9

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_001295569.1 Gene:nkx2.2a / 30697 ZFINID:ZDB-GENE-980526-403 Length:273 Species:Danio rerio


Alignment Length:229 Identity:110/229 - (48%)
Similarity:132/229 - (57%) Gaps:51/229 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   476 PTAHALHNNNNN-------TTNNNNHSLKAEGINGAGSGHDDSLNEDGIEEDIDDVDDADGSGGG 533
            |..:..::|::|       ||::..:||     :|..:...|: :....|...|:..|.|..  .
Zfish    63 PLKNPFYDNSDNPYTRWLATTDSIQYSL-----HGLSANSQDT-SAKSPEPSADESPDNDKE--T 119

  Fly   534 DANGSDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRY 598
            .:||||.  .|||||||||:|||||||||||||||||||||||||||||||||||||||||||||
Zfish   120 SSNGSDS--GKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRY 182

  Fly   599 KTKRAQNEKGYEGHPGLLHGHATHPHHPSALPSPRRVAVPVLVRNGKPC-------LGDSSKLGA 656
            |.|||:.|||.|         .||      ||||||||||||||:||||       |..:.:.|.
Zfish   183 KMKRARAEKGME---------VTH------LPSPRRVAVPVLVRDGKPCHTLKAQDLAATFQAGI 232

  Fly   657 DCVSVSS------------ATATAMQNAAAHHLV 678
            ...:.|:            :.||..|...|||||
Zfish   233 PFSAYSAQSLQHMQYNAHYSAATTPQFPTAHHLV 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeobox 548..601 CDD:278475 51/52 (98%)
nkx2.2aNP_001295569.1 COG5576 93..218 CDD:227863 91/144 (63%)
Homeobox 132..185 CDD:278475 51/52 (98%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 115 1.000 Domainoid score I6005
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072653at2759
OrthoFinder 1 1.000 - - FOG0002404
OrthoInspector 1 1.000 - - otm25708
orthoMCL 1 0.900 - - OOG6_108087
Panther 1 1.100 - - LDO PTHR24340
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2570
SonicParanoid 1 1.000 - - X524
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.810

Return to query results.
Submit another query.