DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vnd and nkx2.5

DIOPT Version :9

Sequence 1:NP_476786.2 Gene:vnd / 31003 FlyBaseID:FBgn0261930 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_571496.2 Gene:nkx2.5 / 30696 ZFINID:ZDB-GENE-980526-321 Length:314 Species:Danio rerio


Alignment Length:192 Identity:78/192 - (40%)
Similarity:106/192 - (55%) Gaps:34/192 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   476 PTAHALHNNNNNTTNNNNHSLKAEGINGAGSGH-----------DDSLNEDGIEE-DIDDVDDAD 528
            |:..:|.:.:......|    |...||.:.||.           .|:..:|..|: :..|:....
Zfish    61 PSGSSLFSEDLQEDKGN----KINSINFSASGFYAKNFLEMDYVKDAKTDDTFEDKEKKDIGCCQ 121

  Fly   529 GSGGGDANGSDGLPNKKRKR---RVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVK 590
            ...|.|....|....|:|||   ||||::||.|||||||:||:|||||||:|||::::||.||||
Zfish   122 EDPGEDLKLDDAERPKQRKRRKPRVLFSQAQVYELERRFKQQKYLSAPERDHLANVLKLTSTQVK 186

  Fly   591 IWFQNHRYKTKRAQNEKGYEGHPGLLHGHATHPHHPSALPSPRRVAVPVLVRNGKPCLGDSS 652
            |||||.|||.||.:.::..|               ...:..|||::||||||:|||||||:|
Zfish   187 IWFQNRRYKCKRQRQDQTLE---------------MVGIAPPRRISVPVLVRDGKPCLGDTS 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vndNP_476786.2 Homeobox 548..601 CDD:278475 40/55 (73%)
nkx2.5NP_571496.2 Homeobox 144..197 CDD:306543 39/52 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0842
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.